SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009816 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009816
Domain Number 1 Region: 46-72,196-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-53
Family G proteins 0.0000000319
Further Details:      
 
Domain Number 2 Region: 76-200
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.03e-40
Family Transducin (alpha subunit), insertion domain 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009816   Gene: ENSGGOG00000010062   Transcript: ENSGGOT00000010098
Sequence length 377
Comment pep:known_by_projection chromosome:gorGor3.1:5:18642425:18689818:1 gene:ENSGGOG00000010062 transcript:ENSGGOT00000010098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
Download sequence
Identical sequences A0A024R8M0 A0A096NTW9 A0A0D9QVL0 A0A2K5LAT7 A0A2K5TVH0 A0A2K6DCB6 G3R3I9 H9EP41 Q14344
ENSP00000400717 ENSGGOP00000009816 ENSP00000400717 9606.ENSP00000400717 gi|24111250|ref|NP_006563.2| ENSP00000400717 ENSGGOP00000009816 NP_006563.2.87134 NP_006563.2.92137 XP_004041157.1.27298 XP_005584778.1.63531 XP_008010259.1.81039 XP_011717830.1.29376 XP_011887437.1.92194 XP_014975612.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]