SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009817 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009817
Domain Number 1 Region: 27-110,139-204
Classification Level Classification E-value
Superfamily EF-hand 2.4e-26
Family Calmodulin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 447-528,566-576
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.24e-19
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 582-767
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.000000000000924
Family Flavohemoglobin, C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009817   Gene: ENSGGOG00000010059   Transcript: ENSGGOT00000010099
Sequence length 767
Comment pep:known_by_projection chromosome:gorGor3.1:15:48375778:48418179:1 gene:ENSGGOG00000010059 transcript:ENSGGOT00000010099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF
FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCAWQGASAGTE
WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD
GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRPRRPRQLTRAYWHNHRSQ
LFCLATYAGLHVLLFALAASAHQDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRA
TWLAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRP
GIGWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPN
FWKWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLY
LNIPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRS
VTMRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFAS
ILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEM
DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRP
DWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
Download sequence
Identical sequences G3R3J0
XP_004056446.1.27298 ENSGGOP00000009817 ENSGGOP00000009817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]