SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009830 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009830
Domain Number 1 Region: 101-174
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000562
Family Calcium ATPase, transduction domain A 0.0083
Further Details:      
 
Domain Number 2 Region: 19-105
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000157
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009830   Gene: ENSGGOG00000010077   Transcript: ENSGGOT00000010113
Sequence length 188
Comment pep:novel chromosome:gorGor3.1:9:36162089:36174554:1 gene:ENSGGOG00000010077 transcript:ENSGGOT00000010113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHERYLQANNKAFNSIFGYPNNAIKTSKYSVFNFLPLNLFEQFQRLANAYFLILLFLQLI
PQISSLTWYTTMTPLMVVLLTAVKDAIDDLKRHQSDDRVNNRPVLLLVNGKIKEDKWMNV
QVGDIIKLENNQPVMADILLLSSSEPYSLTYVETADLDGETNLKVKQAISVTSDMEDRLE
LLSTFNGE
Download sequence
Identical sequences ENSGGOP00000009830 ENSGGOP00000009830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]