SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009837 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009837
Domain Number 1 Region: 22-289
Classification Level Classification E-value
Superfamily PP2C-like 1.98e-116
Family PP2C-like 0.000000000642
Further Details:      
 
Domain Number 2 Region: 297-367
Classification Level Classification E-value
Superfamily Protein serine/threonine phosphatase 2C, C-terminal domain 1.24e-26
Family Protein serine/threonine phosphatase 2C, C-terminal domain 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009837   Gene: ENSGGOG00000010082   Transcript: ENSGGOT00000010120
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:14:41174654:41231674:1 gene:ENSGGOG00000010082 transcript:ENSGGOT00000010120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
Download sequence
Identical sequences A0A024R6A5 A0A0D9RNZ6 A0A1D5QCM8 A0A2I3LD19 A0A2I3STA3 A0A2K5H7R4 A0A2K5MZ46 A0A2K5TTV9 A0A2K5Y9H3 A0A2K6DUT7 A0A2K6RD30 G3R3K7 H2NLE9 P35813
1a6qA gi|10337595|ref|NP_066283.1| 1a6q_A ENSP00000378514 ENSP00000432966 ENSPANP00000017039 ENSGGOP00000009837 ENSPPYP00000006672 ENSMMUP00000013710 9544.ENSMMUP00000013710 9598.ENSPTRP00000010871 9600.ENSPPYP00000006672 NP_066283.1.87134 NP_066283.1.92137 XP_005267836.1.92137 XP_005267838.1.92137 XP_005561471.1.63531 XP_005561472.1.63531 XP_005561473.2.63531 XP_007985048.1.81039 XP_007985050.1.81039 XP_008955235.1.60992 XP_008955236.1.60992 XP_008955237.1.60992 XP_008955238.1.60992 XP_008955239.1.60992 XP_008955240.1.60992 XP_008955241.1.60992 XP_008955242.1.60992 XP_009247399.1.23681 XP_009247400.1.23681 XP_009247401.1.23681 XP_009247402.1.23681 XP_009426171.1.37143 XP_009426172.1.37143 XP_010361420.1.97406 XP_011535180.1.92137 XP_011535181.1.92137 XP_011535182.1.92137 XP_011535183.1.92137 XP_011535184.1.92137 XP_011535185.1.92137 XP_011535186.1.92137 XP_011725848.1.29376 XP_011725849.1.29376 XP_011725850.1.29376 XP_011725851.1.29376 XP_011725852.1.29376 XP_011817322.1.43180 XP_011823699.1.47321 XP_011917393.1.92194 XP_011917394.1.92194 XP_011917395.1.92194 XP_011917396.1.92194 XP_014203059.1.60992 XP_014999302.1.72884 XP_014999303.1.72884 XP_014999304.1.72884 XP_014999305.1.72884 XP_015309340.1.63531 XP_015309342.1.63531 XP_016781651.1.37143 XP_016781652.1.37143 XP_016781653.1.37143 XP_016781654.1.37143 XP_016876873.1.92137 XP_016876874.1.92137 XP_016876875.1.92137 XP_016876876.1.92137 XP_017714919.1.44346 XP_017714920.1.44346 XP_017714921.1.44346 XP_017714922.1.44346 XP_017714923.1.44346 XP_018865577.1.27298 XP_018865578.1.27298 XP_018865579.1.27298 XP_018865580.1.27298 XP_018865581.1.27298 XP_018865582.1.27298 ENSMMUP00000013710 ENSMMUP00000029302 ENSP00000378514 ENSPPYP00000006672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]