SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009848 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009848
Domain Number 1 Region: 782-903,957-1144
Classification Level Classification E-value
Superfamily L domain-like 3.74e-42
Family Internalin LRR domain 0.031
Further Details:      
 
Domain Number 2 Region: 1335-1359,1394-1417
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000125
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009848   Gene: ENSGGOG00000010081   Transcript: ENSGGOT00000010131
Sequence length 1722
Comment pep:known_by_projection chromosome:gorGor3.1:12:83868733:84071441:1 gene:ENSGGOG00000010081 transcript:ENSGGOT00000010131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHYINII
KNRSKAVEELILQDLEDTDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKE
EFMRSKTDCASPDFVPEPSPRDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKE
LEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKQEQDKMNDELYKEE
KIWKEKFKQHEEYIRNLHLQMEEERTRFKDQQEKEKNCLLKQQNNAAVKIQAKYKAFVAY
QKYGPIIKEQIESKKRKAQEWKEKEAKIRQKEEENRKRSEEEQRIKEERKKQKEEERKRR
EKEYEEKKNIVKQEREQLISKEKIILREDASQQLIISSALKKRGYNNKHLSLEDISNDKG
DIAKNLVDENSKKQEDVLLWLVEESNMEENVDRQTILKESIQVKLKESISSQTILADFKM
EENNENLAKKRCSEELVKQERKYENTDNKTELGNSDLKGNLKEQFPLQELKSDAQKEEKI
MKHVINENTGQKTQIILGHNQEINEVKTNEEQKIIKDNQQKKIQKVEKEEIQEQNGLLYK
DKDTSVISVKQKSLSVTSENSKDVGENVILQEKEIYSKSKEIEENPKDNAWNSGIVIFNT
TDTVINIEGKRNDQDYVLGRHAPCEGLSNYNAESSMVSKEVNSLKSEIRNISEKCHENAP
VPDSMTCCVSESTLLYSIEERRLAWIKSFKPWLEIFKQNQQKKIVRRKRPVKCPANMTPA
LDKLEILQCGPWDTLQQVTTVTFQDLPGCVLSTLAECTNLQFLSLRRCGLTSLHSLSNCK
KLKYIDAQENHIEAIECENLENLCVVLLNKNQLTSLHGLDGCTNIQCLELSHNKITRIGY
SFFLEENLVDNTGFCHHLGTSTSYLSLAQVWIPTGLCWSRIPVTSLTKNSDCNFLISHLY
WNCGLESLKNLQQLILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGIENCGLLQILKL
QGNYLSELPSLENLVLLRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHF
VSLEKLDVSHNCLSDLKSAIKWFEACYSLRELSLTGNPLLQETNWRDSLLKVLPALRILN
GNILNSNSESRSEEHNQLGSAGFLALCQSQIREFNLLIENYITGKGDVFTLDTAENLCHY
FKKLMILSTEYRHAHERGDVSITKKDETEAQKNHLAPTNSDSTLQNGVFYSCAHEGNPDS
PDIPEKWMDSVSSHSPLSKSSTCENMEGRHQEILVCQKREDSKASSIPTIRIPFEEVVMT
NSLLRNHQNIEPSEKIMAAVVIQSYWRGYLMRRQIHFSTRLHTAATEGLPNSSIKNQTIL
KKGKRENIVNIRKQREKAAILIQAVWKGFILRKKLTTALEAIKNEESDEEYREIDLEDFI
FDEAALEEEWLALDSTRFPSQTLLLSNQLHWPKIPGNLKWDDTSLNLPSNPAQAWLCNDK
ENLSSSEHTQFNSRSENKTSSWTPESKTNRKSLLKSEKEKKISEEWGFKDISTAQQMLKR
AQKMKSKKLKKKIDSTVRLALFKNNENKVSIPKSPKMVQPRRDGYFEGIEEDPIHKDTTA
NEKLERNREYTYQWLHTQVGVHETTSSRNMKCNHFLPELDPDVLNGGRVQLVARLVSRED
TDLDLFSTSNGSALSVNREKENQAHRHSAGSSSKLWFPSELI
Download sequence
Identical sequences G3R3L8
ENSGGOP00000009848 ENSGGOP00000009848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]