SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009875 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009875
Domain Number - Region: 161-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.011
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009875   Gene: ENSGGOG00000010117   Transcript: ENSGGOT00000010159
Sequence length 633
Comment pep:known_by_projection chromosome:gorGor3.1:11:107866829:107901497:1 gene:ENSGGOG00000010117 transcript:ENSGGOT00000010159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYFPANHGNKEVFSCRGIKLAVDWFLERGHKDITVFVPAWRKEQSRPDALITDQEILR
KLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGIIVSNDNYRDLANEKPEWKKFI
DERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGKKCTYGHKCKY
YHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ
SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPP
QDQRPQGQYPSMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERR
FSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSR
LNPQPFLQNFHDPLTRGQSYSHEEPKFHHKPPLPHLALHLQHSAVGARSSCPGDYPSPPS
SAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERPGYGIDAYGYR
QTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREKIYINLCNIFP
PDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY
Download sequence
Identical sequences ENSGGOP00000009875 ENSGGOP00000009875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]