SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009877 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009877
Domain Number 1 Region: 148-279
Classification Level Classification E-value
Superfamily FKBP-like 4.91e-40
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 42-156
Classification Level Classification E-value
Superfamily FKBP-like 1.51e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 258-376
Classification Level Classification E-value
Superfamily FKBP-like 7.86e-37
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 4 Region: 389-487
Classification Level Classification E-value
Superfamily FKBP-like 8.45e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 5 Region: 495-568
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000307
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009877   Gene: ENSGGOG00000010119   Transcript: ENSGGOT00000010161
Sequence length 582
Comment pep:known_by_projection chromosome:gorGor3.1:5:42243364:42255134:-1 gene:ENSGGOG00000010119 transcript:ENSGGOT00000010161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSRGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPQASLVFHVLLIDVHNPKDTVQLETLELPPGCVRRAGAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEV
ELVSREDGLPTGYLFVWHEDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPG
QDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL
Download sequence
Identical sequences G3R3P6
XP_018882651.1.27298 ENSGGOP00000009877 ENSGGOP00000009877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]