SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009882 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009882
Domain Number 1 Region: 1141-1303,1331-1410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 611-838
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.37e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1458-1704
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-33
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 79-200,302-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-24
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009882   Gene: ENSGGOG00000010106   Transcript: ENSGGOT00000010166
Sequence length 2113
Comment pep:known_by_projection chromosome:gorGor3.1:22:23893418:24011352:1 gene:ENSGGOG00000010106 transcript:ENSGGOT00000010166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPAGLEEPLDGADPHVPHPDLAPVAFF
CLRQTTSPRNWCIKMVCEPLWACLFMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAMRILVNLLLDTLPMLGNVLL
LCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGD
NGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPH
KGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCL
VVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRAL
GLYQALQSRRQALGPEAPAPAKPGPHAKEPRHYNGKTKGQGDKGRHLGSRHCQTLHGPAS
PGNDHSGRGKPGPRELCPQHSPLDATPHTLVQPIPATLASDPASCPCCQHEAGRRPSGLG
STDSGQEGSGSGSSAGGEDEADGDGARSSEDGASSELGKEEEEEEQADGAVWLCGDVWRE
TRAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQATELTNILEICNVVFTSMFALEMI
LKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPAL
RRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLL
WAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAE
GDANRSYSDEDQSSSNTEEFDKLQEGLDSSGDPKLCPIPMTPNGHLDPSLPLGGHLGPAG
AAGPAPRLSLQPDPMLLALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSAAWASRR
SSWNSLKHKPPSAEHESLLSAERGGGARVCEVAADEGPPRAAPLHAPHAHHVHHGPHLAH
RHRHHRRTLSLDNRDSVDLAELVPTVGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTK
MGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIA
HKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGL
YFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISR
APGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSD
CMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWML
LYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLP
YYATYCHTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTT
VFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMR
VLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCND
ENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPL
YFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPGPRLPTGS
PGAPGRGPGGAGGGGDTEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSI
FHHYSSPAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSK
GELDPPEPMRVGDLGECFFPLSSTAISPDPENFLCEMEEIPFNPVRSWLKHDSSQAPPSP
FSPDASSPLLPMPAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLR
QATGSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRRALGPPVPAPGPRAGLSPAARRRLS
LRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGRGGAGGGGAGSEHSETLS
SLSLTSLFCPPPP
Download sequence
Identical sequences ENSGGOP00000009882 ENSGGOP00000009882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]