SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009901 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009901
Domain Number 1 Region: 1971-2194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.66e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 7.5e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1801-1965
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-21
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-20
Family Fibronectin type III 0.0000204
Further Details:      
 
Domain Number 5 Region: 624-786
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000193
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000535
Family Fibronectin type III 0.00000287
Further Details:      
 
Domain Number 8 Region: 1621-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000115
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000246
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 10 Region: 1170-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000121
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 11 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000419
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 12 Region: 1530-1617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000664
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 13 Region: 1441-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000177
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009901
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0026
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00662
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009901   Gene: ENSGGOG00000010138   Transcript: ENSGGOT00000010186
Sequence length 2201
Comment pep:known_by_projection chromosome:gorGor3.1:9:97577005:97674669:-1 gene:ENSGGOG00000010138 transcript:ENSGGOT00000010186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGQCIDGQCICDEGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGSCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFAGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQRSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAAQNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGKTPNLGEFVVAKVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDAVRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSVEIPGLRAGT
PYTITLHGEVRGHSTRPLAVEVITEELPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWTATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVMDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQPVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTNLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences ENSGGOP00000009901 ENSGGOP00000009901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]