SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009918 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009918
Domain Number 1 Region: 73-218
Classification Level Classification E-value
Superfamily EF-hand 2.38e-40
Family Calmodulin-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009918   Gene: ENSGGOG00000010165   Transcript: ENSGGOT00000010205
Sequence length 220
Comment pep:known_by_projection chromosome:gorGor3.1:11:64429476:64434004:-1 gene:ENSGGOG00000010165 transcript:ENSGGOT00000010205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCAKRPWRQGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPGPGIQGYSVLNSLVGPACI
FLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELI
EISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAA
LKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences G3R3T6
XP_004051691.1.27298 ENSGGOP00000009918 ENSGGOP00000009918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]