SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009954 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009954
Domain Number 1 Region: 282-645
Classification Level Classification E-value
Superfamily SIS domain 1.76e-106
Family double-SIS domain 0.000000497
Further Details:      
 
Domain Number 2 Region: 15-172,213-257
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.21e-43
Family Class II glutamine amidotransferases 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009954   Gene: ENSGGOG00000010197   Transcript: ENSGGOT00000010242
Sequence length 645
Comment pep:known_by_projection chromosome:gorGor3.1:5:164880686:164919703:-1 gene:ENSGGOG00000010197 transcript:ENSGGOT00000010242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGVAIDGNNHEVKERHIQLVKKRGKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHG
VPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVF
DNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTE
QIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFL
EDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESV
FNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPV
MVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISR
ETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPEL
IKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELK
HGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIE
LPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSGGOP00000009954 ENSGGOP00000009954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]