SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009957 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000009957
Domain Number - Region: 70-100
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 0.0638
Family Signal peptide-binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009957   Gene: ENSGGOG00000010207   Transcript: ENSGGOT00000010245
Sequence length 215
Comment pep:novel chromosome:gorGor3.1:14:47559667:47566087:1 gene:ENSGGOG00000010207 transcript:ENSGGOT00000010245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGANSSGCYLPSKIRSSKIDDNYLKELNEDLKLRKQELLEMLKPLEDKNNLLFQKLMS
NLEEKQRSLQIMRQIMAGKGCEESSVMELLKEAEKMKQNLERKNKMLRKEMEMLWNKTFE
AEELSDQQKAPQTKNKADLQDGKEKQQRKMEWVKYQEQNNILQNDFHGKVIELRIEALKN
YQKANDLKLSLYLLQNFEPMQAFLNLPGSQGIRIV
Download sequence
Identical sequences ENSGGOP00000009957 ENSGGOP00000009957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]