SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009961 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009961
Domain Number 1 Region: 382-489
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 88-195
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-31
Family SH2 domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009961   Gene: ENSGGOG00000010206   Transcript: ENSGGOT00000010249
Sequence length 494
Comment pep:novel chromosome:gorGor3.1:1:47658481:47758113:-1 gene:ENSGGOG00000010206 transcript:ENSGGOT00000010249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPGTSRRDGVEGAVVMPAVPPPGAVGWRLSGAMYNTVWSMDRDDADWREVMMPYSTELI
FYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTF
LVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQ
YNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQ
EIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRL
GEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLN
VWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSK
KGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVR
LAYPVHAQMPSLCR
Download sequence
Identical sequences ENSGGOP00000009961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]