SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009968 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009968
Domain Number 1 Region: 1-216
Classification Level Classification E-value
Superfamily GFP-like 6.8e-62
Family Domain G2 of nidogen-1 0.0018
Further Details:      
 
Domain Number 2 Region: 395-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 221-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000121
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009968   Gene: ENSGGOG00000010220   Transcript: ENSGGOT00000010256
Sequence length 636
Comment pep:known_by_projection chromosome:gorGor3.1:9:113978521:113990031:1 gene:ENSGGOG00000010220 transcript:ENSGGOT00000010256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPQGSWGSMTGVINGRKFGVATLNTSVMQEAHSGVSSIHSSIRHVPANVGPLMRVLLVT
IAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGELLTMTQVAQGLDPDGLLLLDVV
VNGVVPESLADTDLQVQDFEEHYVQTGPGQLFVGSTQRFFQGSLPSFLRCNHSIQYNAAR
GPQPQLVQHLRASAISSAFDPEAEALRFQLTTALQAEENEVGCPEGFELDSQGAFCVDRD
ECSGGPSPCSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCREGQLCVNLL
GSYRCLPDCGPGFRVAADGAGCEAFQPLPFSGTWNPVDLQPGITGGGAARAAMQPGGTET
GEGDREEAQIWRGMVCPLGEGLWARPPHHQPCPCLPDVDECLEGLDDCHYNQLCENTPGG
HRCSCPRGYRMQGPSLPCLDLDECRMRNLCQHACRNTEGSYQCLCPTGYRLLPSGKNCQD
INECEEESIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCFRRCSQDCGTGGPSTL
QYRLLPLPLGVRAHHDVARLTAFSEAGVPANRTELSMLEPDPRSPFALRPLRAGLGAVYT
RRALTRAGLYRLTVRAAAPRHQSVFVLLIAVSPYPY
Download sequence
Identical sequences ENSGGOP00000009968 ENSGGOP00000009968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]