SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009979 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009979
Domain Number 1 Region: 431-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-82
Family Protein kinases, catalytic subunit 0.000000255
Further Details:      
 
Domain Number 2 Region: 10-107
Classification Level Classification E-value
Superfamily L domain-like 2.38e-19
Family Ngr ectodomain-like 0.00077
Further Details:      
 
Domain Number 3 Region: 127-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000014
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 238-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000787
Family I set domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009979   Gene: ENSGGOG00000010222   Transcript: ENSGGOT00000010267
Sequence length 756
Comment pep:known_by_projection chromosome:gorGor3.1:15:67638784:67949912:-1 gene:ENSGGOG00000010222 transcript:ENSGGOT00000010267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLS
WQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMN
ISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNV
HAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEF
VVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNP
LGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDTFGVSIAVGLAAFAC
VLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVI
GMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPT
KDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHG
DLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATR
NCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIM
YRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVM
LGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Download sequence
Identical sequences ENSGGOP00000009979 ENSGGOP00000023998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]