SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010009 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010009
Domain Number 1 Region: 290-449
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.35e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000279
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 190-287
Classification Level Classification E-value
Superfamily LCCL domain 4.32e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010009   Gene: ENSGGOG00000010252   Transcript: ENSGGOT00000010298
Sequence length 788
Comment pep:known_by_projection chromosome:gorGor3.1:3:97838874:97939610:-1 gene:ENSGGOG00000010252 transcript:ENSGGOT00000010298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSFSMPLFLLLLLVLLLLL
QDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSSVCEWEIRVKMGERVRIKFGDFDIE
DSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFL
ASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGV
HAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESG
VIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKI
TGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFL
PPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTDPPKI
AKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVL
TTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGFYLMVSLACRHNEGWWKGMKQFLPAKA
VDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEA
GYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGLPSTSTFKATGNQ
PPPLVGTYNTLLSRTDSCSSAQAQYDTPKGGKPGPPAPDELVYQVPQSTQEVSGAGRDGE
CDVFKEIL
Download sequence
Identical sequences ENSGGOP00000010009 ENSGGOP00000010009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]