SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010012 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010012
Domain Number 1 Region: 180-214,243-469
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 130-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010012   Gene: ENSGGOG00000010263   Transcript: ENSGGOT00000010302
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:1:196679536:196890247:-1 gene:ENSGGOG00000010263 transcript:ENSGGOT00000010302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRECDWGLGAVKSDLACVPSAKRLLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNH
HSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTK
CEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKR
RRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLL
WSDPADNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPG
FSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNA
ILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHM
EDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences A0A2I2ZN06 A0A2I3T916 A0A2J8V665
ENSP00000355904 ENSP00000353108 ENSGGOP00000010017 ENSGGOP00000010012 NP_001230447.1.87134 NP_001230447.1.92137 XP_011507569.1.92137 XP_011507570.1.92137 XP_011507571.1.92137 XP_016794154.1.37143 ENSP00000355904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]