SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010017 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010017
Domain Number 1 Region: 152-434
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010017   Gene: ENSGGOG00000010263   Transcript: ENSGGOT00000010307
Sequence length 435
Comment pep:known_by_projection chromosome:gorGor3.1:1:196679536:196915362:-1 gene:ENSGGOG00000010263 transcript:ENSGGOT00000010307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPP
LYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE
LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE
DVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK
VPMHKLFLEMLEAKV
Download sequence
Identical sequences A0A1U7U2V5 A0A2I3HQE9 A0A2I3LIF7 A0A2J8QV29 A0A2J8V601 A0A2K5CE56 A0A2K5HGT8 A0A2K5ZZZ5 A0A2K6DWH5 A0A2K6GGY7 A0A2K6KDR3 A0A2K6QJS9 A0A2K6U1H4 F1D8R6 F1SA88 F7IGB3 G3GRF2 G3R430 J9NWD9
ENSMUSP00000106563 ENSMUSP00000106564 ENSGGOP00000010017 NP_001127757.1.87134 NP_001127757.1.92137 NP_001230438.1.87134 NP_001230438.1.92137 NP_001230439.1.87134 NP_001230439.1.92137 NP_001230440.1.87134 NP_001230440.1.92137 NP_001230441.1.87134 NP_001230441.1.92137 NP_001230442.1.87134 NP_001230442.1.92137 NP_001230443.1.87134 NP_001230443.1.92137 NP_001230444.1.87134 NP_001230444.1.92137 NP_001230448.1.87134 NP_001230448.1.92137 NP_001230721.1.92730 NP_976081.1.100692 NP_976081.1.4139 NP_996317.1.87134 NP_996317.1.92137 NP_996318.1.87134 NP_996318.1.92137 XP_001171804.1.37143 XP_001171963.1.37143 XP_001171976.1.37143 XP_003265145.1.23891 XP_003265146.1.23891 XP_003265147.1.23891 XP_003265148.1.23891 XP_003265149.1.23891 XP_003265150.1.23891 XP_003265151.1.23891 XP_003265152.1.23891 XP_003930396.1.74449 XP_004013643.1.66739 XP_004088100.1.23891 XP_004271082.1.21590 XP_004271083.1.21590 XP_004271084.1.21590 XP_004375991.1.4749 XP_004578694.1.84141 XP_004699956.1.18182 XP_005348910.1.66349 XP_005540918.1.63531 XP_005540919.1.63531 XP_005981976.1.78601 XP_005981977.1.78601 XP_006155896.1.99106 XP_006155897.1.99106 XP_006155898.1.99106 XP_006155899.1.99106 XP_006155900.1.99106 XP_006155901.1.99106 XP_006155902.1.99106 XP_006155903.1.99106 XP_006155904.1.99106 XP_006155905.1.99106 XP_006497227.1.92730 XP_006497228.1.92730 XP_006497230.1.92730 XP_006497233.1.92730 XP_006869755.1.41390 XP_006972134.1.50099 XP_007641534.1.69978 XP_007950708.1.48129 XP_007986631.1.81039 XP_007986633.1.81039 XP_007986634.1.81039 XP_008066574.1.4292 XP_008066575.1.4292 XP_008066576.1.4292 XP_008266641.1.1745 XP_008266646.1.1745 XP_008965023.1.60992 XP_008983455.1.60252 XP_009235950.1.23681 XP_009235953.1.23681 XP_009235955.1.23681 XP_009439774.1.37143 XP_010339241.1.74449 XP_010339243.1.74449 XP_010364786.1.97406 XP_010364790.1.97406 XP_010364798.1.97406 XP_010364807.1.97406 XP_010364816.1.97406 XP_010364825.1.97406 XP_010597711.1.64505 XP_010597712.1.64505 XP_010811398.1.76553 XP_010811399.1.76553 XP_010811400.1.76553 XP_010811402.1.76553 XP_010821348.1.59421 XP_010821349.1.59421 XP_010821350.1.59421 XP_010821351.1.59421 XP_010851591.1.44457 XP_010851592.1.44457 XP_010851593.1.44457 XP_010851594.1.44457 XP_011759514.1.29376 XP_011759515.1.29376 XP_011759516.1.29376 XP_011759517.1.29376 XP_011759518.1.29376 XP_011759519.1.29376 XP_011784815.1.43180 XP_011784816.1.43180 XP_011784817.1.43180 XP_011784818.1.43180 XP_011784819.1.43180 XP_011784820.1.43180 XP_011784821.1.43180 XP_011784823.1.43180 XP_011784824.1.43180 XP_011842772.1.47321 XP_011842773.1.47321 XP_011842774.1.47321 XP_011842775.1.47321 XP_011842776.1.47321 XP_011842777.1.47321 XP_011842778.1.47321 XP_011842779.1.47321 XP_011842780.1.47321 XP_011842781.1.47321 XP_011996121.1.54773 XP_011996124.1.54773 XP_011996125.1.54773 XP_012042417.1.66739 XP_012042420.1.66739 XP_012042421.1.66739 XP_012315088.1.9421 XP_012315089.1.9421 XP_012315091.1.9421 XP_012315092.1.9421 XP_012315093.1.9421 XP_012362113.1.23891 XP_012362114.1.23891 XP_012362115.1.23891 XP_012388918.1.21590 XP_012520368.1.63892 XP_012601029.1.48125 XP_012601030.1.48125 XP_012601031.1.48125 XP_012601032.1.48125 XP_012601033.1.48125 XP_012601034.1.48125 XP_012601035.1.48125 XP_012601036.1.48125 XP_012601037.1.48125 XP_012601039.1.48125 XP_012601040.1.48125 XP_012601041.1.48125 XP_012601042.1.48125 XP_012601043.1.48125 XP_012601044.1.48125 XP_012601045.1.48125 XP_012601046.1.48125 XP_012601047.1.48125 XP_013966657.1.84170 XP_013966658.1.84170 XP_013966659.1.84170 XP_013966660.1.84170 XP_013966661.1.84170 XP_013966662.1.84170 XP_013966663.1.84170 XP_013966664.1.84170 XP_013966665.1.84170 XP_013966666.1.84170 XP_013966667.1.84170 XP_013966668.1.84170 XP_013966669.1.84170 XP_014593559.1.31192 XP_014705368.1.49734 XP_014954640.1.66739 XP_014954641.1.66739 XP_014954642.1.66739 XP_014954643.1.66739 XP_014954644.1.66739 XP_014954645.1.66739 XP_014963424.1.54773 XP_014963425.1.54773 XP_014963426.1.54773 XP_014963427.1.54773 XP_014963428.1.54773 XP_014963429.1.54773 XP_014963430.1.54773 XP_015338815.1.40921 XP_015864717.1.50099 XP_015864730.1.50099 XP_015864736.1.50099 XP_015864739.1.50099 XP_015864740.1.50099 XP_015864742.1.50099 XP_015864745.1.50099 XP_015864752.1.50099 XP_015864754.1.50099 XP_016794231.1.37143 XP_016794239.1.37143 XP_016794247.1.37143 XP_016856127.1.92137 XP_016856128.1.92137 XP_016856129.1.92137 XP_016856130.1.92137 XP_016856131.1.92137 XP_016856132.1.92137 XP_016856133.1.92137 XP_016856134.1.92137 XP_016856135.1.92137 XP_016856136.1.92137 XP_016856137.1.92137 XP_016856138.1.92137 XP_017454353.1.100692 XP_017454354.1.100692 XP_017454355.1.100692 XP_017454356.1.100692 XP_017454357.1.100692 XP_017454358.1.100692 XP_017454359.1.100692 XP_018886097.1.27298 XP_018886102.1.27298 XP_018886104.1.27298 XP_018886110.1.27298 XP_019661720.1.58354 XP_019775877.1.83887 XP_019775878.1.83887 XP_019775879.1.83887 XP_020760706.1.74333 XP_020760715.1.74333 XP_020760725.1.74333 XP_020760731.1.74333 XP_020919773.1.46622 XP_020919774.1.46622 XP_020919775.1.46622 XP_020919776.1.46622 XP_020919777.1.46622 XP_020919778.1.46622 XP_020919779.1.46622 XP_020919780.1.46622 XP_020919781.1.46622 XP_020919782.1.46622 XP_020919783.1.46622 XP_020919784.1.46622 XP_020919785.1.46622 XP_020919786.1.46622 XP_020919787.1.46622 XP_020919788.1.46622 XP_020919790.1.46622 XP_021053417.1.100879 XP_021510426.1.76796 XP_021532840.1.9421 XP_021588663.1.77405 XP_021588664.1.77405 9600.ENSPPYP00000000223 gi|197209821|ref|NP_001127757.1| gi|45545427|ref|NP_996317.1| gi|45545429|ref|NP_996318.1| ENSCJAP00000027935 ENSCJAP00000027977 ENSCJAP00000027983 ENSCJAP00000038519 ENSCJAP00000049696 ENSP00000352077 ENSP00000353108 ENSP00000354584 ENSP00000355225 ENSP00000355905 ENSP00000355907 ENSP00000417374 ENSP00000419155 ENSP00000419594 ENSCAFP00000037484 ENSP00000352077 ENSP00000353108 ENSP00000354584 ENSP00000355225 ENSP00000355905 ENSP00000355907 ENSP00000375761 ENSP00000417374 ENSP00000419155 ENSP00000419594 ENSP00000481528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]