SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010026 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010026
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010026
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.000209
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010026   Gene: ENSGGOG00000010276   Transcript: ENSGGOT00000010316
Sequence length 165
Comment pep:known_by_projection chromosome:gorGor3.1:1:2457512:2459007:-1 gene:ENSGGOG00000010276 transcript:ENSGGOT00000010316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAHQPACGLWRPW
Download sequence
Identical sequences G3R439 H2R0I1
ENSPTRP00000040760 9598.ENSPTRP00000040760 ENSPTRP00000040760 ENSGGOP00000010026 ENSGGOP00000010026 XP_004024566.1.27298 XP_016805650.1.37143 XP_524847.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]