SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010042 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010042
Domain Number 1 Region: 542-709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.75e-52
Family G proteins 0.0000196
Further Details:      
 
Domain Number 2 Region: 51-122
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000857
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010042   Gene: ENSGGOG00000010289   Transcript: ENSGGOT00000010332
Sequence length 731
Comment pep:known_by_projection chromosome:gorGor3.1:12:3717035:3856770:-1 gene:ENSGGOG00000010289 transcript:ENSGGOT00000010332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQ
TCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
NNPSQEDAGEQVAQRHEEKVYLSRGDEDLGEMGEDEEAQFWMLMDRLGAQKVLEDESDVK
QLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEM
EQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE
TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQR
EKAGLLKQLDFLRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRG
ILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISIEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSAS
APDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWD
TAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL
DNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQV
GHPAKKKSCCG
Download sequence
Identical sequences ENSGGOP00000010042 ENSGGOP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]