SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010043 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010043
Domain Number 1 Region: 296-380
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.36e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 389-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 134-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 22-124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000192
Family Canonical RBD 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010043
Domain Number - Region: 220-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000906
Family Eukaryotic type KH-domain (KH-domain type I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010043   Gene: ENSGGOG00000010286   Transcript: ENSGGOT00000010333
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:7:23587279:23755301:-1 gene:ENSGGOG00000010286 transcript:ENSGGOT00000010333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSET
AVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGS
SRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGA
AEKSITILSTPEGTSAACKSILEIMHKEAQDIKLLQELTLYNPERTITVKGNVETCAKAE
EEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQF
EQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPP
EAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAE
VVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
Download sequence
Identical sequences ENSGGOP00000010043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]