SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010087 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010087
Domain Number 1 Region: 175-577
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.24e-150
Family Myotubularin-like phosphatases 0.00000000000109
Further Details:      
 
Domain Number 2 Region: 49-172
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-44
Family GRAM domain 0.000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010087   Gene: ENSGGOG00000010339   Transcript: ENSGGOT00000010380
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:11:93196087:93248393:-1 gene:ENSGGOG00000010339 transcript:ENSGGOT00000010380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKLAEMEEPPLLPGENIKD
MAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGGASSRGE
NSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVVPENGW
KLLDQSIQWQRNGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGR
IPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVN
AVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLEST
HWLEHIKKRIALAGALRIADKVESGKMPVVVHCSDGCDRTAQLTSLAMLMLDGYYRTIRG
FEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYF
LIKFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLL
EDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQ
KKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences ENSGGOP00000010087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]