SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010090 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010090
Domain Number 1 Region: 63-147
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.77e-18
Family HSP20 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010090   Gene: ENSGGOG00000010345   Transcript: ENSGGOT00000010384
Sequence length 173
Comment pep:novel chromosome:gorGor3.1:21:31847632:31851402:1 gene:ENSGGOG00000010345 transcript:ENSGGOT00000010384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Download sequence
Identical sequences A0A140G945 A0A2I3RKP9 G3R496 P02489
NP_000385.1.92137 NP_001300979.1.87134 NP_001300979.1.92137 XP_003823906.1.60992 XP_004062925.1.27298 XP_514927.2.37143 ENSP00000291554 ENSP00000291554 ENSP00000291554 ENSP00000482816 ENSPTRP00000024016 gi|4503055|ref|NP_000385.1| ENSGGOP00000010090 GO.56412 HR2894 ENSPTRP00000024016 9598.ENSPTRP00000024016 9606.ENSP00000291554 ENSGGOP00000010090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]