SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010116 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010116
Domain Number 1 Region: 116-334
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000374
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010116   Gene: ENSGGOG00000010370   Transcript: ENSGGOT00000010410
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:5:124210290:124211983:-1 gene:ENSGGOG00000010370 transcript:ENSGGOT00000010410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIR
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
Download sequence
Identical sequences B3Y6B5 G3R4C0
ENSGGOP00000010116 XP_004042694.1.27298 ENSGGOP00000010116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]