SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010128 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010128
Domain Number 1 Region: 375-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-70
Family Protein kinases, catalytic subunit 0.000000000212
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-32
Family SH2 domain 0.000000152
Further Details:      
 
Domain Number 3 Region: 148-260
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-31
Family SH2 domain 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010128   Gene: ENSGGOG00000010377   Transcript: ENSGGOT00000010422
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:9:72648432:72744805:1 gene:ENSGGOG00000010377 transcript:ENSGGOT00000010422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCQYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Download sequence
Identical sequences G3R4D0
ENSGGOP00000010128 XP_004048293.1.27298 ENSGGOP00000010128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]