SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010130 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000010130
Domain Number - Region: 274-339,372-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0534
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number - Region: 512-583
Classification Level Classification E-value
Superfamily PMT central region-like 0.0732
Family PMT central region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010130   Gene: ENSGGOG00000010384   Transcript: ENSGGOT00000010424
Sequence length 624
Comment pep:known_by_projection chromosome:gorGor3.1:5:121401702:121448735:1 gene:ENSGGOG00000010384 transcript:ENSGGOT00000010424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV
MSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNHQLYNLKNSSRIY
YENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYST
SNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNA
NVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQE
VKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTETYSDFYF
LACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLTRCIKDIVGFAIMFFIIFFA
YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFF
VLLNMFLAIINDTYSEVKADYSIGRRPDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTK
GSGDLAEQARREGFDENEIQKAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYA
VELEKELHYINLKLNQVVRKVSAL
Download sequence
Identical sequences A0A2I2YNR7
XP_004042616.1.27298 ENSGGOP00000010130 ENSGGOP00000010130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]