SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010170 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010170
Domain Number 1 Region: 295-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-66
Family SPRY domain 0.00000491
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-22
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 89-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000443
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010170   Gene: ENSGGOG00000010426   Transcript: ENSGGOT00000010467
Sequence length 485
Comment pep:known_by_projection chromosome:gorGor3.1:11:4556547:4564931:-1 gene:ENSGGOG00000010426 transcript:ENSGGOT00000010467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLC
RAPVQPRNLRPNWQLANVVEKVRLLRLHPGMGLKGDLCERHGEKLKMFCKEDVLIMCEAC
SQSPEHEAHSVVPMEDVAWEYKWELHEALEHLKKEQEEAWKLEVGERKRTATWKIQVETR
KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQV
LWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLGLREILKT
YAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGSQCISSGRHYW
EVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPLLSLPVPP
RRVGIFVDYEAHDISFYNVTDYGSHIFTFPRYPFPGRLLPYFSPCYSIGTNNTAPLAICS
LDGED
Download sequence
Identical sequences G3R4G7
ENSGGOP00000010170 ENSGGOP00000010170 XP_004050559.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]