SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010180 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000010180
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.0196
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010180   Gene: ENSGGOG00000010433   Transcript: ENSGGOT00000010477
Sequence length 242
Comment pep:known_by_projection chromosome:gorGor3.1:10:81596629:81642294:1 gene:ENSGGOG00000010433 transcript:ENSGGOT00000010477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VK
Download sequence
Identical sequences ENSGGOP00000010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]