SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010187 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010187
Domain Number 1 Region: 61-366,432-641
Classification Level Classification E-value
Superfamily SNF-like 2.48e-164
Family SNF-like 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010187   Gene: ENSGGOG00000010440   Transcript: ENSGGOT00000010486
Sequence length 730
Comment pep:known_by_projection chromosome:gorGor3.1:12:83682005:83735125:-1 gene:ENSGGOG00000010440 transcript:ENSGGOT00000010486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDE
RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLTVIGIPLFFLELS
VGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWD
QCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTICLLAAWVMVC
LAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPKLEIMLEPKVWR
EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKA
NVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSAVTAEDYHLVYDIIQKVKEEEFPA
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIE
GIVTPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILE
NIAVCFVYGIDKFMEDLKDMLGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYN
AWIEAKASEEFLSYPTWGLVVCVSLVVFAILPVPVVFIVRRFNLIDDSSGNLASVTYKRG
RVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMAD
IMPDMPESDL
Download sequence
Identical sequences G3R4I3
XP_004053680.1.27298 ENSGGOP00000010187 ENSGGOP00000010187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]