SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010194 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010194
Domain Number 1 Region: 145-244
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-33
Family Ras-binding domain, RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 287-401
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010194
Domain Number - Region: 105-188
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0602
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010194   Gene: ENSGGOG00000010446   Transcript: ENSGGOT00000010493
Sequence length 607
Comment pep:known_by_projection chromosome:gorGor3.1:10:29729129:29800918:1 gene:ENSGGOG00000010446 transcript:ENSGGOT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQ
AQKESSQNQHHSASLQASNFSGAASLGYGANVAATGISQYEDDLPPPPADPVLDLPLPPP
PPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVL
DNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKY
AVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGK
KSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVL
KHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYGKTLYDNYQRAVAKAGLASRWTNLG
TVNAAAPAQPSTVFDKKPALGNHHPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPAMPPKA
KGIGGGGLPAPPDDFLPPPPPPPPLDHPELPLPPPDFMEPPPDFVPPPPPSYAGTAGSEL
PPPPPPPPPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQ
KKRGNVS
Download sequence
Identical sequences ENSGGOP00000010194 ENSGGOP00000010194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]