SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010203 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010203
Domain Number 1 Region: 512-664,698-763
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000863
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 210-396
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000628
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010203
Domain Number - Region: 422-476
Classification Level Classification E-value
Superfamily EF-hand 0.0865
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010203   Gene: ENSGGOG00000010443   Transcript: ENSGGOT00000010502
Sequence length 888
Comment pep:known_by_projection chromosome:gorGor3.1:12:112830072:112902413:1 gene:ENSGGOG00000010443 transcript:ENSGGOT00000010502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYIAQTGLELLGSSSSPTLTSQSAEITEDASNGGVSEQHPWPSGFERELKPETISSP
GYHILRATGEENMAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQ
APSLSSGGESSPSSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLF
YLMELATALLLLLLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFI
RHKRTMVKTSVLVVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQS
LPPFMDILLLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMP
SYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRL
LISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAAL
KWKAKKNREHWFDELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGG
NFFSKHVPWSYLVFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALN
MEPFYFIVVLRPLQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEF
FCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNN
WYIIMEGVTSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGG
ITLEKEISKEELVAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDL
SLKMYQEEIQEWYEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
Download sequence
Identical sequences G3R4J8
ENSGGOP00000010207 XP_004053985.1.27298 ENSGGOP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]