SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010207 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010207
Domain Number 1 Region: 504-656,690-755
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000738
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 202-388
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000738
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010207
Domain Number - Region: 414-468
Classification Level Classification E-value
Superfamily EF-hand 0.0865
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010207   Gene: ENSGGOG00000010443   Transcript: ENSGGOT00000010506
Sequence length 880
Comment pep:known_by_projection chromosome:gorGor3.1:12:112818445:112904917:1 gene:ENSGGOG00000010443 transcript:ENSGGOT00000010506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLELLGSRGIFFLASESSQTLEDASNGGVSEQHPWPSGFERELKPETISSPGYHILRAT
GEENMAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGG
ESSPSSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATA
LLLLLLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVK
TSVLVVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDIL
LLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWS
CVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLISQRRPA
GISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNR
EHWFDELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVP
WSYLVFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIV
VLRPLQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPN
CCNTSTVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGV
TSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEIS
KEELVAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEE
IQEWYEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
Download sequence
Identical sequences ENSGGOP00000010207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]