SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010227 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010227
Domain Number 1 Region: 47-191,355-469,845-1052
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.32e-115
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 474-493,632-899
Classification Level Classification E-value
Superfamily HAD-like 3.14e-53
Family Meta-cation ATPase, catalytic domain P 0.00031
Further Details:      
 
Domain Number 3 Region: 481-690
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.48e-47
Family Metal cation-transporting ATPase, ATP-binding domain N 0.003
Further Details:      
 
Domain Number 4 Region: 193-291
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.18e-26
Family Calcium ATPase, transduction domain A 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010227   Gene: ENSGGOG00000010467   Transcript: ENSGGOT00000010526
Sequence length 1256
Comment pep:known_by_projection chromosome:gorGor3.1:1:183681165:183756460:1 gene:ENSGGOG00000010467 transcript:ENSGGOT00000010526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGKMTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSR
LKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISL
VLSFYRPAGEENERIVCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEK
QFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKID
ESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEG
EKKKKGKNKREKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKE
KSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVK
FFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTG
TLTMNRMTVVQAYIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLP
RQVGNKTECALLGFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRM
YSKGASEIILRKCNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDA
EPSWDNENEILTELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIAT
KCGILTPGDDFLCLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVGEHRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASL
ALATEPPTESLLKRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGR
KAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQ
RLLFVFASSPGLCFFLLCTMLYSSVNLKRQIAKWNRFISAIPTRSLKFLKEAGHGTTKEE
ITKDAEGLDEIDHAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVLRRQNMGQH
LDVSENSSSLTPLHIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLD
EEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Download sequence
Identical sequences ENSGGOP00000010227 ENSGGOP00000010227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]