SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010243 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010243
Domain Number 1 Region: 288-477
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-59
Family alpha-catenin/vinculin 0.00024
Further Details:      
 
Domain Number 2 Region: 122-245
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.51e-57
Family alpha-catenin/vinculin 0.00000158
Further Details:      
 
Domain Number 3 Region: 1-120
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-42
Family alpha-catenin/vinculin 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010243   Gene: ENSGGOG00000010490   Transcript: ENSGGOT00000010543
Sequence length 521
Comment pep:known_by_projection chromosome:gorGor3.1:2a:81760794:82099785:1 gene:ENSGGOG00000010490 transcript:ENSGGOT00000010543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEG
VKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDIT
SVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAG
VYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIR
KAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIA
EQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINA
AKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGG
ELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPE
KKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
Download sequence
Identical sequences F7IAE0 M3YAW7
ENSGGOP00000010243 ENSMPUP00000008474 ENSCJAP00000031285 ENSGGOP00000010243 ENSSSCP00000008810 ENSMPUP00000008474 ENSSSCP00000008810 ENSCJAP00000031285 ENSFCAP00000022729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]