SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010249 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010249
Domain Number 1 Region: 395-599
Classification Level Classification E-value
Superfamily VPS9 domain 1.28e-35
Family VPS9 domain 0.0012
Further Details:      
 
Domain Number 2 Region: 56-162
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-16
Family SH2 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010249   Gene: ENSGGOG00000010504   Transcript: ENSGGOT00000010549
Sequence length 784
Comment pep:known_by_projection chromosome:gorGor3.1:11:63218318:63222778:-1 gene:ENSGGOG00000010504 transcript:ENSGGOT00000010549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGESGAGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVLSLRE
RLLLTRPVWLQLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSH
YILESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAIHRAATHKELEAISHL
GIEFWSSSLNIKAQRGPAGGPVLPQLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREK
FKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTERLPPCQLLRRESSVGYRVPAG
SGPSLPPMPSLQEVDCGSPSSSEEEGVPGSRGSPATSPHLGRRRPLLRSMSAAFCSLLAP
ERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPE
KLLSPKRLAEHVLEKSLHRSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGA
FGSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMVLRTQEGEGAGADEF
LPLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLP
LSPVQELRRSLSLWEQRRLPATHCFQHLLQVAYQDPSSGCTSKTLAVPPEASIATLNQLC
ATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAATEVEGS
GQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSQ
AAEE
Download sequence
Identical sequences ENSGGOP00000010249 ENSGGOP00000010249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]