SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010286 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010286
Domain Number 1 Region: 124-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.5e-147
Family Myotubularin-like phosphatases 0.0000000324
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 2.98e-17
Family GRAM domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010286
Domain Number - Region: 524-566
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010286   Gene: ENSGGOG00000010545   Transcript: ENSGGOT00000010590
Sequence length 660
Comment pep:known_by_projection chromosome:gorGor3.1:8:16982661:17059753:-1 gene:ENSGGOG00000010545 transcript:ENSGGOT00000010590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDHCKTQRVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDTRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDK
EEREQGWVLIDLSEEYKRMGLPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPVLSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHS
QTQGTLHLPTTPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEE
RLEKIQNVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA
Download sequence
Identical sequences ENSGGOP00000010286 ENSGGOP00000010286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]