SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010302 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010302
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily t-snare proteins 9.42e-28
Family t-snare proteins 0.00000407
Further Details:      
 
Domain Number 2 Region: 125-184
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000126
Family SNARE fusion complex 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010302   Gene: ENSGGOG00000010565   Transcript: ENSGGOT00000010606
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:10:126333224:126710133:1 gene:ENSGGOG00000010565 transcript:ENSGGOT00000010606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH
Download sequence
Identical sequences A0A2I2ZMC7 H2RC26 Q96AJ9
9598.ENSPTRP00000056669 9606.ENSP00000376792 ENSPTRP00000056669 gi|113374156|ref|NP_660207.2| ENSP00000376792 ENSP00000376792 ENSGGOP00000010302 ENSGGOP00000010302 ENSPTRP00000005198 ENSP00000376792 NP_660207.2.87134 NP_660207.2.92137 XP_001147118.1.37143 XP_003825639.1.60992 XP_004050158.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]