SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010315 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010315
Domain Number 1 Region: 146-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.06e-40
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000284
Further Details:      
 
Domain Number 2 Region: 52-144
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.09e-26
Family Cold shock DNA-binding domain-like 0.00000497
Further Details:      
 
Domain Number 3 Region: 10-49
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000181
Family ECR1 N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010315   Gene: ENSGGOG00000010578   Transcript: ENSGGOT00000010619
Sequence length 271
Comment pep:known_by_projection chromosome:gorGor3.1:9:114239208:114256025:1 gene:ENSGGOG00000010578 transcript:ENSGGOT00000010619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGHFELPSYPFFVSSPCIRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGD
IVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLIS
AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVRRQKTHLHDLPCGASVILGNNGF
IWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEA
SLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences ENSGGOP00000010315 ENSGGOP00000010315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]