SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010316 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010316
Domain Number 1 Region: 43-364
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.13e-60
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000419
Further Details:      
 
Domain Number 2 Region: 359-496
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.35e-24
Family Ricin B-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010316   Gene: ENSGGOG00000010571   Transcript: ENSGGOT00000010620
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:14:50463560:50497365:1 gene:ENSGGOG00000010571 transcript:ENSGGOT00000010620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYS
SDLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPK
VKCLRNDRREGLIRSRVRGADVAAATVLTFLDSHCEVNTEWLPPMLQRVKEDHTRVVSPI
IDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTRPIRTPVIAGGIFVI
DKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGN
ALTYIFRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLEN
VYPELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDH
LIQQQGKCLAATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQL
VTSKCQADAQAQQWQLLPHT
Download sequence
Identical sequences ENSGGOP00000010316 ENSGGOP00000010316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]