SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010318 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010318
Domain Number 1 Region: 165-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.48e-16
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000321
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010318
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00982
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010318   Gene: ENSGGOG00000010583   Transcript: ENSGGOT00000010622
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:12:113071939:113081099:-1 gene:ENSGGOG00000010583 transcript:ENSGGOT00000010622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGT
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW
Download sequence
Identical sequences G3R4V4 H2Q6Y3 Q9H2C1
gi|11641283|ref|NP_071758.1| ENSP00000261731 ENSPTRP00000009320 ENSP00000261731 9598.ENSPTRP00000009320 9606.ENSP00000261731 NP_071758.1.87134 NP_071758.1.92137 XP_001153819.2.37143 XP_003832477.1.60992 XP_004053995.1.27298 ENSP00000261731 ENSPTRP00000009320 ENSGGOP00000010318 ENSGGOP00000010318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]