SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010343 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010343
Domain Number 1 Region: 414-589,617-685
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000204
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 61-299
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000204
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010343   Gene: ENSGGOG00000010594   Transcript: ENSGGOT00000010647
Sequence length 737
Comment pep:known_by_projection chromosome:gorGor3.1:11:66031819:66066179:1 gene:ENSGGOG00000010594 transcript:ENSGGOT00000010647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQPRVPSMLGERGRGLLCSCAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRY
YSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFA
ADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQ
NSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQN
LPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRG
YLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLRKVQLDSSHKQ
AMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPGYQSPFLQSAQFLFGHYYFDYL
GNLIALANLVTICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYL
SYPSNVFDGLLTIVLLLKVLEISTLAVYRLPHPGWRPEMLGLLSLWDMTRMLNMLIVFRF
LRIIPSMKPMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVAPPGNSSLA
PANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFV
LWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGE
DELTERLSQHPHLWLCR
Download sequence
Identical sequences ENSGGOP00000010343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]