SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010361 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010361
Domain Number 1 Region: 37-142
Classification Level Classification E-value
Superfamily E set domains 0.00000000024
Family Filamin repeat (rod domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010361   Gene: ENSGGOG00000010626   Transcript: ENSGGOT00000010665
Sequence length 517
Comment pep:known_by_projection chromosome:gorGor3.1:11:106180090:106206469:-1 gene:ENSGGOG00000010626 transcript:ENSGGOT00000010665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELDRSRAPPTMRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYF
YLQAVNSEGQNLTRSPPGETPFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETV
DEGLKIEVLYGDEHVAQSPYILKGPVYHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASF
PSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEILLSLTRKVL
LPDLEFYVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVT
NDLLSIQGNTGPSWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKE
KELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPW
KHYVPIKRNLSDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAE
RQSSKPEVRDGMELVPQPEDSTTICQCHRKKPSREEL
Download sequence
Identical sequences ENSGGOP00000010361 ENSGGOP00000010361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]