SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010362 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010362
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily L domain-like 4.76e-21
Family U2A'-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010362
Domain Number - Region: 496-580
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0017
Family PspA lactotransferrin-binding region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010362   Gene: ENSGGOG00000010622   Transcript: ENSGGOT00000010666
Sequence length 647
Comment pep:known_by_projection chromosome:gorGor3.1:17:93586716:93625155:-1 gene:ENSGGOG00000010622 transcript:ENSGGOT00000010666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAGPRLVLSEEAVRAKSGLGPHRDLAELRSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRESERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCT
EALAKQSLVMDVDDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKTPWSQLCGELPPPYGAEPEASRAPGPHAYFTPH
PDSVDTEDSASSQKLDMSAEMVPGPLPAPGKCRKRRMPVGRLQTFSDQEGLGCLERTHGS
SVPEESLRRQDNSESRNGRTLSQPEALETEEQRSRGVTDTREPSPGSHLALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDGSAMVGEDVGSLALE
SKSLQSRLAEQQQQHAREMSEVTAELHRTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTRMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQELKKTMALFPHSSASHGGRQAC
Download sequence
Identical sequences G3R4Z6
XP_004059141.2.27298 XP_018869049.1.27298 ENSGGOP00000010362 ENSGGOP00000010362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]