SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010370 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010370
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EF-hand 0.000000326
Family Polcalcin 0.064
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000243
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010370   Gene: ENSGGOG00000010627   Transcript: ENSGGOT00000010675
Sequence length 131
Comment pep:known_by_projection chromosome:gorGor3.1:7:103129041:103143958:-1 gene:ENSGGOG00000010627 transcript:ENSGGOT00000010675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSSRELQAAEYLEKHHIKELVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLSTEDEDLQDDGHKITLDKFKEEV
NKRMKEIWSAF
Download sequence
Identical sequences G3R504
XP_004046053.1.27298 XP_018886602.1.27298 ENSGGOP00000010370 ENSGGOP00000010370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]