SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010387 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010387
Domain Number 1 Region: 123-306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-37
Family SPRY domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010387   Gene: ENSGGOG00000010652   Transcript: ENSGGOT00000010692
Sequence length 316
Comment pep:known_by_projection chromosome:gorGor3.1:8:27253370:27260116:-1 gene:ENSGGOG00000010652 transcript:ENSGGOT00000010692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHE
IERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLA
SVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHA
WEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPAT
SPLVLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEP
LRICPLHISVKEELDG
Download sequence
Identical sequences ENSGGOP00000010387 ENSGGOP00000010387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]