SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010424 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010424
Domain Number 1 Region: 246-449
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-64
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000145
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.000000695
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-29
Family SH2 domain 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010424   Gene: ENSGGOG00000010689   Transcript: ENSGGOT00000010730
Sequence length 517
Comment pep:novel chromosome:gorGor3.1:12:112001984:112088731:1 gene:ENSGGOG00000010689 transcript:ENSGGOT00000010730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPSKCVKYWPDEYALKEY
GVMRVRNVKESAAHDYTLRELKLSKVGQARVEGNTERTVWQYHFRTWPDHGVPSDPGGVL
DFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQM
VRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGD
QSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
Download sequence
Identical sequences ENSGGOP00000010424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]