SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010426 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010426
Domain Number 1 Region: 235-576
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.69e-131
Family Mammalian PLC 0.00000000114
Further Details:      
 
Domain Number 2 Region: 815-878,919-1090
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 2.75e-70
Family C-terminal domain of PLC-beta 0.0000277
Further Details:      
 
Domain Number 3 Region: 66-233
Classification Level Classification E-value
Superfamily EF-hand 4.83e-53
Family EF-hand modules in multidomain proteins 0.00000666
Further Details:      
 
Domain Number 4 Region: 596-714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.59e-25
Family PLC-like (P variant) 0.0000634
Further Details:      
 
Domain Number 5 Region: 2-64
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000234
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010426   Gene: ENSGGOG00000010674   Transcript: ENSGGOT00000010732
Sequence length 1135
Comment pep:known_by_projection chromosome:gorGor3.1:20:8831970:9094162:1 gene:ENSGGOG00000010674 transcript:ENSGGOT00000010732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNL
LAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDS
IPQEDFTPEVYRVFLNNICPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEI
LYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQP
LSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFT
MTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPL
EKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSS
PGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKR
NKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQM
VALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVK
IISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPT
LACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPD
TYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEAPSEARTTPAE
NGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVK
LQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPS
SPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQK
LTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRS
YIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEI
LEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
Download sequence
Identical sequences ENSGGOP00000010426 ENSGGOP00000010426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]