SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010444
Domain Number 1 Region: 29-132
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000196
Family Glycerol-3-phosphate (1)-acyltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010444   Gene: ENSGGOG00000010711   Transcript: ENSGGOT00000010751
Sequence length 323
Comment pep:known_by_projection chromosome:gorGor3.1:21:32560634:32623140:1 gene:ENSGGOG00000010711 transcript:ENSGGOT00000010751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPLSAELVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFG
VLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLL
YCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFR
GNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGM
FPGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVR
RLIGVTEIEKGSSYGNQEFKKKE
Download sequence
Identical sequences ENSGGOP00000010444 ENSGGOP00000010444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]