SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010490
Domain Number 1 Region: 26-174
Classification Level Classification E-value
Superfamily EF-hand 2.66e-42
Family Calmodulin-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010490   Gene: ENSGGOG00000010756   Transcript: ENSGGOT00000010798
Sequence length 181
Comment pep:known_by_projection chromosome:gorGor3.1:1:1816197:1818666:1 gene:ENSGGOG00000010756 transcript:ENSGGOT00000010798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELER
LMSLLGINPTKSELALMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFD
KEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLI
Q
Download sequence
Identical sequences G3R5B9
ENSGGOP00000010490 ENSGGOP00000010490 XP_004024541.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]