SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010494 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010494
Domain Number 1 Region: 84-389
Classification Level Classification E-value
Superfamily RNI-like 4.82e-61
Family 28-residue LRR 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010494
Domain Number - Region: 417-480
Classification Level Classification E-value
Superfamily EF-hand 0.000228
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010494   Gene: ENSGGOG00000010758   Transcript: ENSGGOT00000010802
Sequence length 488
Comment pep:known_by_projection chromosome:gorGor3.1:14:58114006:58158889:1 gene:ENSGGOG00000010758 transcript:ENSGGOT00000010802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHIQFPSKPTLPRACWEGRITAGSPGMPPHEIEIQPVRQSSDKMLYCEAEPPPTVEKVKP
ARENSETDLEIEDDEKFFTTGQKELYLEACKLVGVVPVSYFIRNMKESYVNLNHHGLGPR
GTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARI
ISDFFERNSSSIWSLELSGNDFKEDSAALLCQALSTNYRIKKLDLSHNQFSDVGGKHLGQ
MLAINVGLTSLDLSWNNFHTRGAVALCNGLRGNVTLTKLDLSMNGFGNEVALALGEVLRL
NSCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNPKS
RMEELDISNVLVSEQFMKTLDGVYAVHPQLDVVFKAVQGLSAKKTIFLLTNPMKLIQSYA
DQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLDEKTGMVNF
SFLNTMKP
Download sequence
Identical sequences ENSGGOP00000010494 ENSGGOP00000010494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]